← Back to catalog
pdb.sequence
mock data$0.001 / callSequence Similarity Search
Search protein structures by amino acid sequence similarity (BLAST). Input a protein sequence and find all PDB structures with matching chains. Configure identity cutoff (e.g. 90%) and E-value threshold. Returns PDB entity IDs ranked by similarity score. Essential for homology modeling and structure prediction (RCSB PDB)
Input schema
limit
integerMaximum number of results (1-50). Default: 10
sequencerequired
stringProtein amino acid sequence in one-letter code (e.g. "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" — first 50 residues of human hemoglobin alpha)
evalue_cutoff
numberMaximum E-value threshold for BLAST significance. Default: 0.1
identity_cutoff
numberMinimum sequence identity (0.1-1.0). Default: 0.9 (90% identical)
Call via REST
curl -X POST https://unifyapi.pro/api/call/pdb.sequence \
-H "Authorization: Bearer uak_live_..." \
-H "Content-Type: application/json" \
-d '{"limit":10,"sequence":"<sequence>","evalue_cutoff":0.1,"identity_cutoff":0.9}'